The domain within your query sequence starts at position 84 and ends at position 304; the E-value for the SGL domain shown below is 8.8e-9.

RIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIF
KFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTS
VVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQL
GTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVL

SGL

SGL
PFAM accession number:PF08450
Interpro abstract (IPR013658):

This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30, Q15493), gluconolactonase (Q01578) and luciferin-regenerating enzyme (LRE, Q86DU5). SMP-30 is known to hydrolyse diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 (P52430) and LRE.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SGL