SMART: Pfam domain SGS

The domain within your query sequence starts at position 162 and ends at position 222; the E-value for the SGS domain shown below is 6.1e-10.

TRWDYLTQVEKECKEKEKPSYDTEADPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREK
Q

SGS

PFAM accession number:	PF05002
Interpro abstract (IPR007699):	The SGT1-specific (SGS) domain is a module of ~90 amino acids, which was initially identified in eukaryotic Sgt1 proteins [ (PUBMED:11847307) ]. It was latter also found in calcyclin-binding proteins [ (PUBMED:12746458) ]. The SGS domain has been shown to bind to proteins of the S100 family, which are thought to function as sensors of calcium ion concentration in the cell [ (PUBMED:12746458) ]. Sgt1 is a highly conserved eukaryotic protein that is required for both SCF (Skp1p/Cdc53p-Cullin-F-box)-mediated ubiquitination and kinetochore function in yeast and also plays a role in the cAMP pathway. Calcyclin (S100A6) is a member of the S100A family of calcium binding proteins and appears to play a role in cell proliferation [ (PUBMED:12577318) ].

PFAM accession number:

PF05002

Interpro abstract (IPR007699):

The SGT1-specific (SGS) domain is a module of ~90 amino acids, which was initially identified in eukaryotic Sgt1 proteins [ (PUBMED:11847307) ]. It was latter also found in calcyclin-binding proteins [ (PUBMED:12746458) ]. The SGS domain has been shown to bind to proteins of the S100 family, which are thought to function as sensors of calcium ion concentration in the cell [ (PUBMED:12746458) ].

Sgt1 is a highly conserved eukaryotic protein that is required for both SCF (Skp1p/Cdc53p-Cullin-F-box)-mediated ubiquitination and kinetochore function in yeast and also plays a role in the cAMP pathway. Calcyclin (S100A6) is a member of the S100A family of calcium binding proteins and appears to play a role in cell proliferation [ (PUBMED:12577318) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SGS