The domain within your query sequence starts at position 42 and ends at position 272; the E-value for the SH3BP5 domain shown below is 2.3e-99.

EEVDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELAKKIGKAVEDS
KPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEM
LNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKY
YVQLEQLKKTVDDLQAKLALAKGEYKAALKSLERISDEIHERRRSNAMGPR

SH3BP5

SH3BP5
PFAM accession number:PF05276
Interpro abstract (IPR007940):

This family consists of several eukaryotic SH3 domain-binding protein 5 or c-Jun N-terminal kinase (JNK)-interacting proteins (SH3BP5 or Sab). Sab binds to and serves as a substrate for JNK in vitro, and has been found to interact with the Src homology 3 (SH3) domain of Bruton's tyrosine kinase (Btk). Inspection of the sequence of Sab reveals the presence of two putative mitogen-activated protein kinase interaction motifs (KIMs) similar to that found in the JNK docking domain of the c-Jun transcription factor, and four potential serine-proline JNK phosphorylation sites in the C-terminal half of the molecule [(PUBMED:12167088)].

This entry also includes REI-1 and REI-2 from C. elegans. REI-1 is a guanine nucleotide exchange factors (GEFs) for RAB-11. It functions in early embryos [(PUBMED:26506309)].

GO process:intracellular signal transduction (GO:0035556)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SH3BP5