The domain within your query sequence starts at position 54 and ends at position 123; the E-value for the SHS2_Rpb7-N domain shown below is 9.2e-13.
RRHIALSPRYLSRKRTGIREQLDAELLRYSESLLGVPIAYDNIRVVGELGDIYDDQGHIH LNIEADFVIF
SHS2_Rpb7-N |
 |
|---|
| PFAM accession number: | PF03876 |
|---|---|
| Interpro abstract (IPR005576): | Rpb7 is a subunit of eukaryotic RNA polymerase (RNAP) II that is homologous to Rpa43 of RNAP I, Rpc8/Rpc25 of RNP III, and RpoE of archaeal RNAP. Rpb7 binds to Rpb4 to form a heterodimer. This complex is thought to interact with the nascent RNA strand during RNA polymerase II elongation [ (PUBMED:11741548) ] and plays a part in transcription, mRNA transport and DNA repair [ (PUBMED:15544954) ]. In RNA polymerase I, Rpa43 is at least one of the subunits contacted by the transcription factor TIF-IA [ (PUBMED:12393749) ]. The N terminus of Rpb7 and homologues has a SHS2 domain that is involved in protein-protein interaction [ (PUBMED:15281131) ]. |
| GO process: | transcription, DNA-templated (GO:0006351) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHS2_Rpb7-N