The domain within your query sequence starts at position 8 and ends at position 77; the E-value for the SHS2_Rpb7-N domain shown below is 1e-18.

EHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVL
YPVKYKAIVF

SHS2_Rpb7-N

SHS2_Rpb7-N
PFAM accession number:PF03876
Interpro abstract (IPR005576):

The eukaryotic RNA polymerase subunits RPB4 and RPB7 form a heterodimer that reversibly associates with the RNA polymerase II core. Archaeal cells contain a single RNAP made up of about 12 subunits, displaying considerable homology to the eukaryotic RNAPII subunits. The RPB4 and RPB7 homologues are called subunits F and E, respectively, and have been shown to form a stable heterodimer. While the RPB7 homologue is reasonably well conserved, the similarity between the eukaryotic RPB4 and the archaeal F subunit is barely detectable [(PUBMED:11741548)].

This entry represents the N-terminal, heterodimerisation domain of RPB7.

GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHS2_Rpb7-N