The domain within your query sequence starts at position 2 and ends at position 445; the E-value for the SID-1_RNA_chan domain shown below is 8.6e-198.

SSSDGGQPCHSDTDSSVEESDFDTMPDIESDKNVIRTKMFLYLSDLSRKDRRIVSKKYKI
YFWNIITIAVFYALPVMQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLG
HVLLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYH
VCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGK
NDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDR
MVLLIVGNLVNWSFAFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLP
VFCIAATAVVWAAALYFFFQNLSSWEGTPAESREKNRECVLLDFFDDHDIWHFLSATALF
FSFLVLLTLDDDLDVVRRDQIPVF

SID-1_RNA_chan

SID-1_RNA_chan
PFAM accession number:PF13965
Interpro abstract (IPR025958):

This is a family of proteins that are transmembrane dsRNA-gated channels. They passively transport dsRNA into cells and do not act as ATP-dependent pumps [(PUBMED:12970568)]. They are required for systemic RNA interference [(PUBMED:11834782),(PUBMED:16202143), (PUBMED:23396108)].

GO process:dsRNA transport (GO:0033227)
GO component:integral component of membrane (GO:0016021)
GO function:RNA transmembrane transporter activity (GO:0051033)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SID-1_RNA_chan