The domain within your query sequence starts at position 52 and ends at position 248; the E-value for the SIMPL domain shown below is 1.5e-26.
VHVSGAAEVSASPDRALVTVRVSSTKEVSAEAKKSVCRRLDYITQSLQQQGFQAENVTVT KNIRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPEFYHTPGSVENLRR QACLVAVENAWRKAQEVCDLVGQTLGKPLLIKEEETKDWEGQTDDHQLSRLPGTLTVQQK IKSATIHAASKVFITFE
SIMPL |
---|
PFAM accession number: | PF04402 |
---|---|
Interpro abstract (IPR007497): | Members of this family have been found in bacteria, archaea and animals. A mouse family member has been named SIMPL (signalling molecule that associates with mouse pelle-like kinase). SIMPL appears to facilitate and/or regulate complex formation between IRAK/mPLK (IL-1 receptor-associated kinase) and IKK (inhibitor of kappa-B kinase) containing complexes, and thus regulate NF-kappa-B activity [ (PUBMED:11096118) ]. Separate experiments demonstrate that a mouse family member (named LaXp180) binds the Listeria monocytogenes surface protein ActA, which is a virulence factor that induces actin polymerisation. It may also bind stathmin, a protein involved in signal transduction and in the regulation of microtubule dynamics [ (PUBMED:11207567) ]. In bacteria its function is unknown, but it is thought to be located in the periplasm or outer membrane. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIMPL