The domain within your query sequence starts at position 18 and ends at position 129; the E-value for the SIN1 domain shown below is 1.2e-32.
HVTSDDTGMCEMVLIDHDVDLEKTHPPSVPGDSGSEVQGSSGETQGYIYAQSVDITSSWD FGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSL
SIN1 |
---|
PFAM accession number: | PF05422 |
---|---|
Interpro abstract (IPR032679): | This entry represents the N-terminal domain of Sin1 (stress-activated map kinase interacting 1). Sin1 homologue from mammals, MAPKAP1, is part of the Target Of Rapamycin Complex 2 (TORC2) complex that plays an essential role in signal transduction [ (PUBMED:17303383) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIN1