The domain within your query sequence starts at position 1 and ends at position 289; the E-value for the SIN1 domain shown below is 2e-125.

MTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNE
PIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRR
KGSQKISGPQYRLEKQSEPNIAVDLESTLESQNAWEFCLVRENSSRADGVFEEDSQIDIA
TVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISI
DCDLLCACDLAEEKSPSHAVFKLTYLSSHDYKHLYFESDAATVSEIVLK

SIN1

SIN1
PFAM accession number:PF05422
Interpro abstract (IPR032679): This entry represents the N-terminal domain of Sin1 (stress-activated map kinase interacting 1). Sin1 homologue from mammals, MAPKAP1, is part of the Target Of Rapamycin Complex 2 (TORC2) complex that plays an essential role in signal transduction [(PUBMED:17303383)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIN1