SMART: Pfam domain SIN1

The domain within your query sequence starts at position 381 and ends at position 488; the E-value for the SIN1_PH domain shown below is 3.4e-34.

HHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCAC
DLAEEKSPSHAVFKLTYLSSHDYKHLYFESDAATVSEIVLKVNYILES

SIN1_PH

PFAM accession number:	PF16979
Interpro abstract (IPR031313):	This entry represents a pleckstrin-homology domain found at the C terminus of Stress-activated map kinase interacting 1 (Sin1) and its Saccharomyces cerevisiae orthologue Avo1. It is conserved from yeast to humans. PH-domains are involved in intracellular signalling or as constituents of the cytoskeleton. Sin1 plays an essential role in signal transduction, and the PH domain is involved in lipid and membrane binding [ (PUBMED:22505404) ].

PFAM accession number:

PF16979

Interpro abstract (IPR031313):

This entry represents a pleckstrin-homology domain found at the C terminus of Stress-activated map kinase interacting 1 (Sin1) and its Saccharomyces cerevisiae orthologue Avo1. It is conserved from yeast to humans. PH-domains are involved in intracellular signalling or as constituents of the cytoskeleton. Sin1 plays an essential role in signal transduction, and the PH domain is involved in lipid and membrane binding [ (PUBMED:22505404) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIN1_PH