The domain within your query sequence starts at position 22 and ends at position 262; the E-value for the SIP1 domain shown below is 4e-82.
PCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPA PEGYSPTLQWQQQQVAHFSTVRQSVHKHRNHWKSQQLDSNVAMPKSEDEEGWKKFCLGER LCAEGATGPSTEESPGIDYVQVGFPPLLSIVSRMNQTTITSVLEYLSNWFGERDFTPELG RWFYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVGSKDDERVPALNLLICLVSRYFDQ R
SIP1 |
---|
PFAM accession number: | PF04938 |
---|---|
Interpro abstract (IPR035426): | This entry includes Gem2 (also known as SIP1) from animals, Brr1 from budding yeasts and yip11/yip12 from fission yeasts. Gem2 is part of the survival of motor neurons (SMN) complex that is involved in UsnRNP assembly in the cytoplasm and mediates nuclear import of the assembled UsnRNP [ (PUBMED:18621711) ]. Brr1 is a nuclear protein involved in mRNA splicing and required for snRNA accumulation and snRNP biogenesis [ (PUBMED:8861964) (PUBMED:8722763) (PUBMED:15911574) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIP1