The domain within your query sequence starts at position 157 and ends at position 301; the E-value for the SIR2_2 domain shown below is 1.9e-21.

ALVLTTNFDNLLELYAADQGKQLESLDLTDEKKVLEWAQEKRKLSVLHIHGVYTNPSGIV
LHPAGYQNVLRNTEVMREIQKLYENKSFLFLGCGWTVDDTTFQALFLEAVKHKSDLEHFM
LVRRGDVDEFKKLRENMLDKGIKVI

SIR2_2

SIR2_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIR2_2