The domain within your query sequence starts at position 75 and ends at position 225; the E-value for the SIR2_2 domain shown below is 7.7e-18.

AAIDFDLLEDEESKKFQKCLHEDKNLVHVAHDLIQKLSPVLEWAQEKRKLSVLHIHGVYT
NPSGIVLHPAGYQNVLRNTEVMREIQKLYENKSFLFLGCGWTVDDTTFQALFLEAVKHKS
DLEHFMLVRRGDVDEFKKLRENMLDKGIKVI

SIR2_2

SIR2_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIR2_2