The domain within your query sequence starts at position 142 and ends at position 286; the E-value for the SIR2_2 domain shown below is 7.8e-20.

TMVLTTNYDNLLEIFGQQQSKPMESLDLKDKTKVLQWARGHIKYGVLHIHGLYTDPCGMV
LDPSGYKDVTQDPEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYM
VVLKENEDHFFKHQADMLLHGIKVV

SIR2_2

SIR2_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIR2_2