The domain within your query sequence starts at position 1 and ends at position 126; the E-value for the SLAM domain shown below is 3.1e-62.
MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKS VRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYL VSVEEN
SLAM |
![]() |
---|
PFAM accession number: | PF06214 |
---|---|
Interpro abstract (IPR010407): | This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones [ (PUBMED:10570270) ]. SLAM has also been recognised as a receptor for Measles virus [ (PUBMED:12610126) ]. |
GO process: | lymphocyte activation (GO:0046649) |
GO component: | integral component of membrane (GO:0016021), cell surface (GO:0009986) |
GO function: | signaling receptor activity (GO:0038023) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLAM