The domain within your query sequence starts at position 1 and ends at position 126; the E-value for the SLAM domain shown below is 3.1e-62.

MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKS
VRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYL
VSVEEN

SLAM

 SLAM
PFAM accession number:PF06214
Interpro abstract (IPR010407):

This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones [ (PUBMED:10570270) ]. SLAM has also been recognised as a receptor for Measles virus [ (PUBMED:12610126) ].

GO process:lymphocyte activation (GO:0046649)
GO component:cell surface (GO:0009986), integral component of membrane (GO:0016021)
GO function:signaling receptor activity (GO:0038023)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLAM