The domain within your query sequence starts at position 266 and ends at position 318; the E-value for the SLBB domain shown below is 8.6e-10.

LFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLI

SLBB

SLBB
PFAM accession number:PF10531
Interpro abstract (IPR019554):

The soluble ligand-binding beta-grasp domain (SLBB) contains a beta-grasp fold. They are found in a diverse set of proteins that include the animal vitamin B12 uptake proteins; transcobalamin, intrinsic factor and the bacterial polysaccharide export proteins [(PUBMED:17250770)]. Some proteins may be part of a membrane complex involved in electron transport, others are probably involved in the export of the extracellular polysaccharide colanic acid from the cell to medium.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLBB