The domain within your query sequence starts at position 773 and ends at position 897; the E-value for the SLC12 domain shown below is 7.1e-20.

HPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGDALAAEQTIKHLMEAEKVKGFCQLVVA
AKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLV
AKNVS

SLC12

SLC12
PFAM accession number:PF03522
Interpro abstract (IPR018491):

This entry represents a domain found in the C-terminal of the solute carrier family 12 (SLC12) members, which are K-Cl cotransporters. The SLC12 family members are predicted to have 12 transmembrane (TM) regions in a central hydrophobic domain, together with hydrophilic N- and C-termini that are likely cytoplasmic. Comparison of their sequences with those of other ion-tranporting membrane proteins reveals that they are part of a new superfamily of cation-chloride co-transporters, which includes the Na-Cl and Na-K-2Cl co-transporters [(PUBMED:8663311), (PUBMED:9930699), (PUBMED:10600773)].

GO process:ion transport (GO:0006811)
GO component:membrane (GO:0016020)
GO function:transporter activity (GO:0005215)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLC12