The domain within your query sequence starts at position 56 and ends at position 355; the E-value for the SLC35F domain shown below is 1.4e-151.

LNREMLISVALGQVLSLLVCGIGLTSKYLAEDFHANTPVFQSFLNYILLFLVYTTTLAVR
QGEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTTLTSVQLLDCFVIPVVILLSWF
FLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLGGATLYGISNV
WEESIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSACMFG
LYSFMPVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGLVLYSS

SLC35F

SLC35F
PFAM accession number:PF06027
Interpro abstract (IPR009262):

This entry contains some of the solute carrier family 35 members, including SLC35F1, SLC35F2 and SLC35F6. In humans, SLC35F6 is involved in the maintenance of mitochondrial membrane potential in pancreatic ductal adenocarcinoma (PDAC) cells. It promotes pancreatic ductal adenocarcinoma (PDAC) cell growth and may play a role as a nucleotide-sugar transporter [(PUBMED:19154410)].

GO process:transmembrane transport (GO:0055085)
GO component:integral component of membrane (GO:0016021)
GO function:transmembrane transporter activity (GO:0022857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLC35F