The domain within your query sequence starts at position 79 and ends at position 157; the E-value for the SLC3A2_N domain shown below is 9.3e-35.

KIKVAEDETEAGVKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVR
APRCRELPVQRWWHKGALY

SLC3A2_N

SLC3A2_N
PFAM accession number:PF16028
Interpro abstract (IPR031984):

Heteromeric amino acid transporters (HATs) are composed of two subunits, a heavy (SLC3 family) and a light subunit [SLC7 or L-type amino acid transporter (LAT) family] linked by a conserved disulfide bridge [ (PUBMED:23506863) ]. HATs are amino acid exchangers, and the transport activity resides in the light subunit. The heavy chain of the surface antigen 4F2 (4F2hc), also known as solute carrier family 3 member 2 protein (Slc3a2), is a HAT heavy subunit [ (PUBMED:9915839) (PUBMED:24516142) ]. 4F2hc controls the cell surface expression as well as the membrane topology of the 4F2 heterodimer [ (PUBMED:9915839) ].

This entry represents the N-terminal domain of 4F2hc.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLC3A2_N