The domain within your query sequence starts at position 17 and ends at position 164; the E-value for the SLY domain shown below is 4.7e-57.

KPKRSSSFGNFDRFRNNSVSKSDDSIEVHDRELTNGSEEQSKTSSSGGSLGKKVRAISWT
MKKKVGKKYIKALSEEKEEESGEEALPYRNSDPMIGTHTEKISLKASDSMDSLYSGQSSS
SGITSCSDGTSNRDSFRLDDDSPYSGPF

SLY

SLY
PFAM accession number:PF12485
Interpro abstract (IPR021090):

This entry represents eukaryotic proteins that are typically between 144 and 156 amino acids in length. The entry is found in association with . There is a conserved LGKK sequence motif. SAM/SH3 domain-containing proteins contain a Src homology 3 domain and a sterile alpha motif, suggesting that they may function as a signaling adaptor protein in lymphocytes [ (PUBMED:11470164) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLY