The domain within your query sequence starts at position 119 and ends at position 189; the E-value for the SM-ATX domain shown below is 8.5e-21.

SRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIV
DTMVFKPSDVL

SM-ATX

SM-ATX
PFAM accession number:PF14438
Interpro abstract (IPR025852):

This SM domain is found in Ataxin-2 [(PUBMED:9462862), (PUBMED:11917006)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SM-ATX