The domain within your query sequence starts at position 306 and ends at position 376; the E-value for the SMAP domain shown below is 4e-16.
IWEKLNFGNKDQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS QTHTQRGMGLG
SMAP |
---|
PFAM accession number: | PF15477 |
---|---|
Interpro abstract (IPR028124): | This domain is found in eukaryotes, and is approximately 70 amino acids in length. It contains a single completely conserved residue G that may be functionally important. It is found in some uncharacterised proteins, including some described as small acidic protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMAP