The domain within your query sequence starts at position 52 and ends at position 1057; the E-value for the SMC_N domain shown below is 9.2e-19.

SIVRIAMENFLTYDICEVSPGPHLNMIIGANGTGKSSIVCAICLGLAGKPAFMGRADKVG
FFVKRGCSKGLVEIELFRTSGNLIITREIDVIKNQSFWFINKKPVTQKIVEEQVAALNIQ
VGNLCQFLPQDKVGEFAKLSKIELLEATEKSVGPPEMHRYHCELKNFREKEKQLETSCKE
KTEYLEKMVQRNERYKQDVERFYERKRHLDLIEMLEAKRPWVEYENVRQEYEGVKLIRDR
VKEEVRKLKEGQIPMTRRIEEIDRQRHTLEVRIKEKSTDIKEASQKCKQRQDLIERKDRQ
IKELQQALTVKQNEELDRQKRISNTRKMIEDLQSELKTAENCENLQPQIDTVTNDLRRVQ
EEKALCEGEIIDKQREKEMLEKQRRSVSDHITRFDNLMNQKEDKLRQRYRDTYDAVLWLR
NNRDRFKQRVCEPIMLTINMKDNKNAKYVENHISSNDLRAFVFESQEDMEIFLREVRDNK
KLRVNAVIAPKISYADKAPSRSLNDLKQYGFFSYLRELFDAPDPVMSYLCCQYHIHEVPV
GTERTRERIERVIQETRLKQIYTAEEKYVLKTSVYSNKVISSNTSLKVAQFLTVTVDLEQ
RRHLEEQLKEMNRQLEAVDSGLAALRDTNRHLELKDNELRLKKKELLERKTRKRQLEQKI
SSKLASIRLMEQDTCNLEEEERKASTKIKEINVQKAKLVTELTGLVKICTSFQIQKVDLI
LQNTTVISEKNKLEADYMASSSQLRVTEQQFIELDDNRQRLLQKCKELMKKARQVCNLSA
DQAVPQEFQTQVPTIPNGHSSSPPMAFQDLPNTLDEIDALLTEERSRASCFTGLNPSVVE
EYSKREVEIQQLTEELQGKKVELDEYRENISQVKERWLNPLKELVEKINEKFSNFFSSMQ
CAGEVDLHTENEEDYDKYGIRIRVKFRSSTQLHELTPHHQSGGERSVSTMLYLMALQELN
RCPFRVVDEINQGMDPINERRVFEMVVNTACKENTSQYFFITPKLL

SMC_N

SMC_N
PFAM accession number:PF02463
Interpro abstract (IPR003395):

This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [(PUBMED:11983169)]. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics [(PUBMED:10429180)]. This domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMC_N