The domain within your query sequence starts at position 54 and ends at position 200; the E-value for the SMC_Nse1 domain shown below is 3e-23.
HRRFLQLLMTHGVLEEWEVRRLQNHCYQVHDRNATVDKLEDFINNINSVLESLYIEIKKG VTEDDGRPIYALVNLATTSVSKMATDFAENELDLFRKALELIVDSETGFASSTNILNLVD QLKGKKMRKKEAEQVLQKFVQSKWLIE
SMC_Nse1 |
 |
|---|
| PFAM accession number: | PF07574 |
|---|---|
| Interpro abstract (IPR011513): | Saccharomyces cerevisiae Nse1 ( Q07913 ) forms part of a complex with SMC5-SMC6. This non-structural maintenance of chromosomes (SMC) complex plays an essential role in genomic stability, being involved in DNA repair and DNA metabolism [ (PUBMED:12966087) (PUBMED:11927594) ]. It is conserved in eukaryotes from yeast to human. Nse1 acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. It also functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks [ (PUBMED:11927594) (PUBMED:12966087) ]. |
| GO process: | DNA repair (GO:0006281) |
| GO component: | Smc5-Smc6 complex (GO:0030915) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMC_Nse1