The domain within your query sequence starts at position 629 and ends at position 1240; the E-value for the SMG1 domain shown below is 9.8e-249.

MWALSPTVFALLSKNLMIVHSDLAVHFPAIQYAVLYTLYSHCTRHDHFISSSLSSSSPSL
FDGAVISTVTTATKKHFSIILNLLGILLKKDNLNQDTRKLLMTWALEVAVLMKKSETYAP
LFSLPSFHKFSKGLLANTLVEDVNICLQACSSLHALSSSLPDDLLQRCVDVCRVQLVHSG
TRIRQAFGKLLKSIPLDVVLSNNNHTEIQEISLALRSHMSKAPSNTFHPQDFSDVISFIL
YGNSHRTGKDNWLERLFYSCQRLDKRDQSTIPRNLLKTDAVLWQWAIWEAAQFTVLSKLR
TPLGRAQDTFQTIEGIIRSLAAHTLNPDQDVSQWTTADNDEGHGSNQLRLVLLLQYLENL
EKLMYNAYEGCANALTSPPKVIRTFFYTNRQTCQDWLTRIRLSIMRVGLLAGQPAVTVRH
GFDLLTEMKTNSLTQGSELEVTIMMVVEALCELHCPEAIQGIAVWSSSAVGKNLLWINSV
AQQAEGRFEKASVEYQEHLCAMTGVDCCISSFDKSVLTLANAGRNSASPKHSLNGESRKT
VLSKSIDSSPEVISYLGNKACECYISIADWAAVQEWQNAVHDLKKNSSSTSLNLKADFNY
IKSLSSFESGEF

SMG1

SMG1
PFAM accession number:PF15785
Interpro abstract (IPR031559):

Serine/threonine-protein kinase SMG1 is a phosphatidylinositol kinase-related protein that acts as an mRNA-surveillance protein and is a key component of nonsense-mediated decay (NMD) [(PUBMED:11331269), (PUBMED:15175154), (PUBMED:12881430), (PUBMED:15314158)]. In C.elegans, SMG1 is a key regulator of growth. Loss of SMG1 leads to hyperactive responses to injury and subsequent growth that continues out of control. It has an antagonistic role to mTOR signalling in worms [(PUBMED:22479207)] and possibly also in higher eukaryotes.

GO process:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (GO:0000184), phosphorylation (GO:0016310)
GO function:protein serine/threonine kinase activity (GO:0004674)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMG1