The domain within your query sequence starts at position 178 and ends at position 369; the E-value for the SMK-1 domain shown below is 9e-72.

NEGYIKKLLQLFHTCEKLKNMEGLYYLHNIIKGILFLNNTRLFNIMFSDEFFMDIVGCLE
YDPALDQPKQYREFLTQNSKFKEVIPIIHSQLRQKIQQTYRMQYVHDIMLPTPSIFQTNL
LSDITTMIFFNKINIITMIQEDENFLLEVFSQLKDNSIGDERRIELLLFLKEFCEFAKTL
QSQKKNELLKTL

SMK-1

SMK-1
PFAM accession number:PF04802
Interpro abstract (IPR006887): This is a conserved region which characterises a number of eukaryotic proteins of unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMK-1