The domain within your query sequence starts at position 1 and ends at position 176; the E-value for the SMRP1 domain shown below is 5.2e-87.

XLPEKYWLSPDEEDKCCPSYLDNDRYNTWKTSPCSNYWNKYTGCLPRLSKDTGMESVRGM
PLEYPPKQERLNAYEREVVVNMLNSLSRNRTLPQIVPRCGCVDPLPGRLPYQGYESPCSG
RHYCLRGMDYCTTREPSTERRLRPLCSQQPTVRSVSPFGHRPGMQCAVTTPPPSFY

SMRP1

SMRP1
PFAM accession number:PF15181
Interpro abstract (IPR028195):

Spermatid-specific manchette-related protein 1 (SMRP1) interacts with alpha-tubulin and may be involved in differentiation or function of ciliated cells [(PUBMED:15242845)]. SMRP1 may play a role in spermatogenesis [(PUBMED:15242845)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMRP1