The domain within your query sequence starts at position 20 and ends at position 82; the E-value for the SNARE domain shown below is 3.4e-13.

ENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTMAR
SGR

SNARE

SNARE
PFAM accession number:PF05739
Interpro abstract (IPR000727):

The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [(PUBMED:9239749), (PUBMED:9232812)]. Target SNAREs (t-SNAREs) are localised on the target membrane and belong to two different families, the syntaxin-like family and the SNAP-25 like family. One member of each family, together with a v-SNARE localised on the vesicular membrane, are required for fusion.

The N- and C-terminal coiled-coil domains of members of the SNAP-25 family and the most C-terminal coiled-coil domain of the syntaxin family are related to each other and form a new homology domain of approximately 60 amino acids. This domain is also found in other known proteins involved in vesicular membrane traffic, some of which belong to different protein families [(PUBMED:9096343)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNARE