The domain within your query sequence starts at position 173 and ends at position 296; the E-value for the SNARE_assoc domain shown below is 2.2e-21.
FPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLLTAWVAARIQNSDKL SAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLMASSAGLLPTQLLNSY LGTT
SNARE_assoc |
---|
PFAM accession number: | PF09335 |
---|---|
Interpro abstract (IPR032816): | This is a family of SNARE associated Golgi proteins. The yeast member of this family,Tvp38, localises with the t-SNARE Tlg2 [ (PUBMED:16107716) ] and is involved in vesicular trafficking and spindle migration [ (PUBMED:17178117) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNARE_assoc