The domain within your query sequence starts at position 1 and ends at position 142; the E-value for the SNF2_N domain shown below is 9e-24.

XTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLK
ADVFKNMPAKTELIVRVELSPMQKLLFYSYLLYIPTLVFRKYYKYILTRNFEALNSRGGG
NQVSLLNIMMDLKKCCNHPYLF

SNF2_N

SNF2_N
PFAM accession number:PF00176
Interpro abstract (IPR000330):

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1) [(PUBMED:7651832), (PUBMED:14729263)]. SNF2 functions as the ATPase component of the SNF2/SWI multisubunit complex, which utilises energy derived from ATP hydrolysis to disrupt histone-DNA interactions, resulting in the increased accessibility of DNA to transcription factors.

Proteins that contain this domain appear to be distantly related to the DEAX box helicases.

GO function:ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNF2_N