The domain within your query sequence starts at position 249 and ends at position 373; the E-value for the SNF5 domain shown below is 3.1e-33.

PTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFV
TTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQ
DRNTR

SNF5

SNF5
PFAM accession number:PF04855
Interpro abstract (IPR006939): SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterised so far [(PUBMED:10325430)]. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex [(PUBMED:11390659)]. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumours (MRTs) [(PUBMED:9671307)].
GO process:chromatin remodeling (GO:0006338)
GO component:nuclear chromosome (GO:0000228)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNF5