SMART: Pfam domain SOAR

The domain within your query sequence starts at position 345 and ends at position 453; the E-value for the SOAR domain shown below is 1.7e-42.

WSVPDALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEVAASYLLQAEKIKKKRSTVFG
TLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQI

SOAR

PFAM accession number:	PF16533
Interpro abstract (IPR032393):	This domain, also known as SOAR, is the Orai1-activating region of STIM1 (stromal interaction molecule 1). STIM1 is a Ca2+ sensor in the endoplasmic reticulum. As the store of calcium is depleted the calcium sensor in the ER activates Orai1, a Ca2+-release-activated Ca2+ (CRAC) channel, in the plasma membrane. The SOAR region forms a dimer, and is essential for oligomerisation of the whole of STIM1 [ (PUBMED:22451904) ].

PFAM accession number:

PF16533

Interpro abstract (IPR032393):

This domain, also known as SOAR, is the Orai1-activating region of STIM1 (stromal interaction molecule 1). STIM1 is a Ca2+ sensor in the endoplasmic reticulum. As the store of calcium is depleted the calcium sensor in the ER activates Orai1, a Ca2+-release-activated Ca2+ (CRAC) channel, in the plasma membrane. The SOAR region forms a dimer, and is essential for oligomerisation of the whole of STIM1 [ (PUBMED:22451904) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SOAR