The domain within your query sequence starts at position 145 and ends at position 197; the E-value for the SOCS domain shown below is 8.4e-20.

TRSGLQRRERRYGVSSMQDMDSVSSRAVGSRSLRQRLQDTVGLCFPMRTYSKQ

SOCS

SOCS
PFAM accession number:PF12610
Interpro abstract (IPR022252):

Suppressors of cytokine signaling (SOCS) proteins play important roles in regulating a variety of signal transduction pathways that are involved in immunity, growth and development of organisms. They share a similar domain organisation, with a central SH2 domain and a conserved C-terminal SOCS box. In contrast, the N-terminal domains vary in length and amino acid sequence. In the case of SOCS4-7, the N-terminal domain accounts for a large proportion of the protein [(PUBMED:22423360)].

This entry represents a conserved region in the N-terminal domains of SOCS4 and 5. This domain is approximately 60 amino acids in length. It is found in association with.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SOCS