The domain within your query sequence starts at position 19 and ends at position 130; the E-value for the SPACA7 domain shown below is 2.2e-47.

WQGAELQPIKTTSGPITEGSLNSTTENIPEALDEILAQEILEPKTSAVSETSPRPRSSIL
TTVQTKEINAGIDENYQEEAFENYHEVLENIEHLPTKEESGKNDRSTVANLH

SPACA7

SPACA7
PFAM accession number:PF15307
Interpro abstract (IPR029301):

Sperm acrosome associated 7 (SPACA7) is expressed only in testis. Its release from the acrosome accelerates the dispersal of cumulus cells surrounding the oocyte and facilitates fertilisation in mice [(PUBMED:24307706)].

GO component:acrosomal vesicle (GO:0001669)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPACA7