The domain within your query sequence starts at position 1 and ends at position 86; the E-value for the SPAN-X domain shown below is 6.2e-9.
MEEQPTQSNTLEKNEGEGPVQRQNKRDEKKEKIIRRVKEVLAQSPNKDKNATVVIVICYR GKKKRNPSQLEKNEGTQDHSSSPNNT
SPAN-X |
---|
PFAM accession number: | PF07458 |
---|---|
Interpro abstract (IPR010007): | This entry represents SPAN-X (Sperm Protein Associated with the Nucleus on the X chromosome) family proteins, including N1, N2, N3 and N5. These human sperm proteins are associated with the nucleus and mapped to the X chromosome (SPAN-X) (approximately 100 residues long). SPAN-X proteins are cancer-testis antigens (CTAs), and thus represent potential targets for cancer immunotherapy because they are widely distributed in tumours but not in normal tissues, except testes. They are highly insoluble, acidic, and polymorphic [ (PUBMED:11133693) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPAN-X