The domain within your query sequence starts at position 1471 and ends at position 1721; the E-value for the SPAR_C domain shown below is 1.6e-96.

KQVDTNAKNVFGQPRLRASLRDLRSPRKNYKSTIEDDLKKLIVMDNLGPEQERDTGQSPQ
KSLQRTLSDESLCSGRREPSFASPASLEPGLPSDVLFTSTCTFPSSTLPARRQHQHAHPP
SGAPSTTPATGNGFPEKKSAISASELSLADGRDRPLRRLDPGMMPLPDTAAGLEWSSLVN
AAKAYEVQRAVSLFSLNDPALSPEIPPAHSPVHSHLSLERGPQTPRATPTMSEESPLDLT
GKVYQLEVMLK

SPAR_C

SPAR_C
PFAM accession number:PF11881
Interpro abstract (IPR021818):

This domain is found in C-terminal of the signal-induced proliferation-associated 1-like (SIPA1L) proteins, including SIPA1L 1-3 from humans. SIPA1Ls shares protein sequence similarity with signal-induced proliferation-associated protein 1 (SIPA1), which is a GTPase activator for the nuclear Ras-related regulatory proteins Rap1 and Rap2 [(PUBMED:9346962), (PUBMED:15310461)]. In rats SIPA1L1 (also known as SPAR) has been identified as a Rap-specific GTPase-activating protein [(PUBMED:11502259)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPAR_C