The domain within your query sequence starts at position 25 and ends at position 154; the E-value for the SPATA19 domain shown below is 2e-82.

NSDIEVEESEAVSVVQHWLNKTEEEASRSIREKMSINDSPTHGHDIHVTRDLVKHHLSKS
DMLTDPSQEVLEERTRIQFIRWSHTRIFQVPSEVMDDVMQERIDQVRRSVSHLMCDSYND
PSFRTSCSEC

SPATA19

SPATA19
PFAM accession number:PF15212
Interpro abstract (IPR028219): Spermatogenesis-associated protein 19 may have a role in spermiogenesis [(PUBMED:15139970), (PUBMED:12688595)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATA19