The domain within your query sequence starts at position 49 and ends at position 169; the E-value for the SPATA24 domain shown below is 1.4e-45.
SKEEFHEIEKKLVEEKAAHAKTKALLAKEEEKLQFALGEVEVLSKQLEKEKMAFEKALSS VKSRVLQESSKKDQLITKCNGRREARAAPQVNIHGLFTNSPMTVPKAGLYPNFCPRLRIQ A
SPATA24 |
![]() |
---|
PFAM accession number: | PF15175 |
---|---|
Interpro abstract (IPR029176): | This family of proteins bind to DNA and to TBP (TATA box binding protein), TATA-binding protein (TBP)-related protein 2 (TRF2) and several polycomb factors. It is likely to function as a transcription regulator [ (PUBMED:18418073) (PUBMED:19515240) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATA24