The domain within your query sequence starts at position 1 and ends at position 91; the E-value for the SPATA6 domain shown below is 1e-33.

MRFVKVFEEAIDPGAVAELLESFLTRFELVQLVSPAWEELAYYEKNTRDFLFPEPRLASS
HLGMQREVLMKTAIWFPGIAPKIEFSTRTAI

SPATA6

SPATA6
PFAM accession number:PF14909
Interpro abstract (IPR032732):

This domain is found in the spermatogenesis associated protein 6 (Spata6) from eukaryotes, and is approximately 140 amino acids in length. Spata6 has similarity with the motor domain of kinesin related proteins and the Caenorhabditis elegans neural calcium sensor protein (NCS-2) [ (PUBMED:12771232) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATA6