The domain within your query sequence starts at position 1 and ends at position 76; the E-value for the SPATIAL domain shown below is 9.6e-27.

MCSAAAFQSSDAMSNRMDGNENTVHIPNYLDQEIKILAKLSEILHTDSLAEVLNWLLQAS
NKEKEWVSALVHSELA

SPATIAL

SPATIAL
PFAM accession number:PF15256
Interpro abstract (IPR037394): This family includes uncharacterised protein C4orf17 and TBATA, also known as Spatial or C4orf17-like. TBATA may be involved in spermatid differentiation [(PUBMED:17196196)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATIAL