The domain within your query sequence starts at position 55 and ends at position 217; the E-value for the SPC25 domain shown below is 2.4e-48.

AVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVL
ALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKL
TFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHD

SPC25

 SPC25
PFAM accession number:PF06703
Interpro abstract (IPR009582):

Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins [ (PUBMED:8632014) ].

This family represents the signal peptidase complex subunit 25kDa subunit (SPC25 or SPCS2) and its homologues, such as Spc2 from budding yeasts. The signal peptidase complex cleaves the signal sequence from proteins targeted to the endoplasmic reticulum (ER). Mammalian signal peptidase is as a complex of five different polypeptide chains [ (PUBMED:8632014) ], while the budding yeast SPC comprises four proteins [ (PUBMED:8663399) ]. Budding yeast Spc2 has been shown to be a nonessential component of the signal peptidase complex [ (PUBMED:8910564) ]. Spc2 has been shown to enhance the enzymatic activity of the SPC and facilitate the interactions between different components of the translocation site [ (PUBMED:10921929) ].

GO process:signal peptide processing (GO:0006465)
GO component:integral component of membrane (GO:0016021), signal peptidase complex (GO:0005787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPC25