The domain within your query sequence starts at position 22 and ends at position 135; the E-value for the SPR1 domain shown below is 1.3e-56.

GNGDPSPGSTDTHEEEDSPPLPLGPPIPGDPWPGAPPLFDEPPPPGSNRPWRDLPDSGAW
PPKPPSTDPPKPPLPDDPWPAGTQPPENPWPPAPEMDHESQEEPDLDPPQEEYR

SPR1

SPR1
PFAM accession number:PF15356
Interpro abstract (IPR029271):

This entry represents SPR1, which is the psoriasis susceptibility locus 2 protein [(PUBMED:12930300)]. Its function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPR1