The domain within your query sequence starts at position 2 and ends at position 51; the E-value for the SPRR2 domain shown below is 2.9e-22.

SYHQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCP

SPRR2

SPRR2
PFAM accession number:PF14820
Interpro abstract (IPR029142):

Small proline-rich (SPRR) proteins are structural components of the cornified cell envelope of stratified squamous epithelia. They are subdivided into three families: SPRR1, SPRR2, and SPRR3 [(PUBMED:9888996)].

This entry represents SPRR2, a family of small proteins rich in proline, cysteine and glutamate. They contain a tandemly repeated nonamer, PKCPEPCPP [(PUBMED:3133554)]. They are components of the cornified envelope of keratinocytes [(PUBMED:11279051)].

GO component:cornified envelope (GO:0001533)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPRR2