The domain within your query sequence starts at position 2 and ends at position 55; the E-value for the SPRR2 domain shown below is 6e-21.
SYQQQQCKQPCQPPPVCPPKKCPEPCPPLKCPEPCPPPKCPEPCPPPKCPEPCP
SPRR2 |
---|
PFAM accession number: | PF14820 |
---|---|
Interpro abstract (IPR029142): | Small proline-rich (SPRR) proteins are structural components of the cornified cell envelope of stratified squamous epithelia. They are subdivided into three families: SPRR1, SPRR2, and SPRR3 [ (PUBMED:9888996) ]. This entry represents SPRR2, a family of small proteins rich in proline, cysteine and glutamate. They contain a tandemly repeated nonamer, PKCPEPCPP [ (PUBMED:3133554) ]. They are components of the cornified envelope of keratinocytes [ (PUBMED:11279051) ]. |
GO component: | cornified envelope (GO:0001533) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPRR2