The domain within your query sequence starts at position 351 and ends at position 493; the E-value for the SPRY domain shown below is 8.7e-14.

KHYWEVDVSGKGAWVLGLSDGSYLFNPIFRSNAERNPLFRRGIKNDSHYQPKYGFWVIGL
WKKSVYNAFEECPFTGKPSVLTLSLMVPPCRVGVFLDYAAGTLSFYNISNNGTLIYRFCT
ASFPDRVFPYFNPMGSSEPMTIC

SPRY

SPRY
PFAM accession number:PF00622
Interpro abstract (IPR003877): The SPRY domain is named from SPla and the RYanodine Receptor. Its function is unknown. Distant homologues are domains in butyrophilin/marenostrin/pyrin [(PUBMED:9204703)]. Ca2+-release from the sarcoplasmic or endoplasmic reticulum, the intracellular Ca2+ store, is mediated by the ryanodine receptor (RyR) and/or the inositol trisphosphate receptor (IP3R).
GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPRY