The domain within your query sequence starts at position 674 and ends at position 776; the E-value for the SPRY domain shown below is 1.5e-9.
VHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAITEGGITKGATIGVLLDLNR KTLTFFVNNEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLP
SPRY |
---|
PFAM accession number: | PF00622 |
---|---|
Interpro abstract (IPR003877): | The SPRY domain is named from SPla and the RYanodine Receptor. Its function is unknown. Distant homologues are domains in butyrophilin/marenostrin/pyrin [ (PUBMED:9204703) ]. Ca 2+ -release from the sarcoplasmic or endoplasmic reticulum, the intracellular Ca 2+ store, is mediated by the ryanodine receptor (RyR) and/or the inositol trisphosphate receptor (IP3R). |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPRY