The domain within your query sequence starts at position 37 and ends at position 127; the E-value for the SPT6_acidic domain shown below is 8.8e-19.
DEEEEEENLDDQDERGNLKDFINDDDDEEEGEEDEGSDSGDSEDDVGHKKRKRPSFDDRL EDDDFDLIEENLGVKVKRGQKYRRVKKMSDD
SPT6_acidic |
 |
|---|
| PFAM accession number: | PF14632 |
|---|---|
| Interpro abstract (IPR028083): | The N terminus of Spt6 is highly acidic. The full Spt6 protein is a transcription regulator, but the exact function of this acidic region is not certain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPT6_acidic