The domain within your query sequence starts at position 2440 and ends at position 2530; the E-value for the SRI domain shown below is 6e-30.
AKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKN PEDLECNENVKHKTKEYIKKYMQKFGAVYKP
SRI |
---|
PFAM accession number: | PF08236 |
---|---|
Interpro abstract (IPR013257): | The SRI (Set2 Rpb1 interacting) domain mediates RNA polymerase II interaction and couples histone H3 K36 methylation with transcript elongation [ (PUBMED:15798214) ]. This domain is conserved from yeast to humans. Members of this family form a compact, closed three-helix bundle, with an up-down-up topology. The first and second helices are antiparallel to each other and are of similar length; the third helix, which is packed across helices alpha1 and alpha2 is slightly shorter, consisting of only 15 amino acids. Most conserved hydrophobic residues are largely buried in the interior of the structure and form an extensive and contiguous hydrophobic core that stabilises the packing of the three-helix bundle. This domain mediates RNA polymerase II interaction and couples histone H3 K36 methylation with transcript elongation [ (PUBMED:16314571) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355), histone lysine methylation (GO:0034968) |
GO component: | chromosome (GO:0005694) |
GO function: | histone-lysine N-methyltransferase activity (GO:0018024) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRI