The domain within your query sequence starts at position 627 and ends at position 699; the E-value for the SRP40_C domain shown below is 1.1e-32.

PFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYR
GGSISVQVNSVKF

SRP40_C

SRP40_C
PFAM accession number:PF05022
Interpro abstract (IPR007718): This presumed domain is found at the C terminus of the Saccharomyces cerevisiae SRP40 protein P32583 and its homologues. SRP40/nopp40 is a chaperone involved in nucleocytoplasmic transport. SRP40 is also a suppressor of mutant AC40 subunit of RNA polymerase I and III.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRP40_C