The domain within your query sequence starts at position 520 and ends at position 584; the E-value for the SRRM_C domain shown below is 1.9e-28.
SPKKPLGRDKDSEGRARHAEAEAARTRRRSRSYSPIRKRRRDSPSFMEPRRITSARKRPI PYYRP
SRRM_C |
 |
|---|
| PFAM accession number: | PF15230 |
|---|---|
| Interpro abstract (IPR029360): | This domain is found near to the C terminus of Serine/arginine repetitive matrix proteins 3 and 4. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRRM_C